PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G146900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 455aa    MW: 48810.9 Da    PI: 8.6636
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G146900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.25.6e-11321366550
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                         kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Sevir.5G146900.1.p 321 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVA 366
                         8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.6E-14317381IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.76319375IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.5E-14321375No hitNo description
PfamPF001708.9E-10321371IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.76E-11321375No hitNo description
CDDcd147031.06E-24322372No hitNo description
PROSITE patternPS000360324339IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MSCDLPRPHS LALFLSPCSD QLNPLSPSPP ACPYHSRCGI AQFSAEETSE PTPPALTVNP  60
PSSRARQAAA RRAPAAGATE KKKGERELKK GTARAIPAPA PVGLTLPPGP SALGRFRRCA  120
ILPACCVDSS NQRARRRVPA MAQLPPKIPT MAPAWPEFGG GHHHHAHHHH QRSPSVGTFL  180
AAPMPPLPPP QQQHQQPSWV DEFLDFSAAK RGAHRRSVSD SVAFLEPGPD DGNAGVGAHD  240
FDRLDDDQLL SMFSDDMPPP PSQQQAAPAP APVASSSSPS DHNSINDEKT DRGETEEAQS  300
KCHGDDAAPG QPASAAAVDP KRVKRILANR QSAQRSRVRK LQYISELERS VTSLQTEVSA  360
LSPRVAFLDH QRSLLTLGNS HLKQRIAALA QDKIFKDAHQ EALKKEIERL RQIYHQQSLK  420
KAESPPAPDA APIRSDKDLI ASEGTAAPAP CPPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0612660.0BT061266.1 Zea mays full-length cDNA clone ZM_BFb0128B20 mRNA, complete cds.
GenBankKJ7275570.0KJ727557.1 Zea mays clone pUT5417 bZIP transcription factor (bZIP117) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968609.10.0PREDICTED: basic leucine zipper 2-like
SwissprotQ5QNI51e-112BZP02_ORYSJ; Basic leucine zipper 2
TrEMBLK3XK880.0K3XK88_SETIT; Uncharacterized protein
STRINGSi002311m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-91bZIP family protein